UROD Antibody
| Name | UROD Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-56662 |
| Prices | $299.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to UROD(uroporphyrinogen decarboxylase) The peptide sequence was selected from the N terminal of UROD. Peptide sequence SLLLLLFLFIVIFALLGMQLFGGRYDFEDTEVRRSNFDNFPQALISVFQV. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | UROD |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: UROD Antibody [NBP1-56662] - HepG2 cell lysate, Antibody Titration: 2.5ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24722_UROD-Antibody-Western-Blot-NBP1-56662-img0001.jpg)
![Immunohistochemistry-Paraffin: UROD Antibody [NBP1-56662] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24723_UROD-Antibody-Immunohistochemistry-Paraffin-NBP1-56662-img0002.jpg)