DAK Antibody
| Name | DAK Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-54881 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to DAK(dihydroxyacetone kinase 2 homolog (S. cerevisiae)) The peptide sequence was selected from the N terminal of DAK. Peptide sequence MTSKKLVNSVAGCADDALAGLVACNPNLQLLQGHRVALRSDLDSLKGRVA. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | TKFC |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: DAK Antibody [NBP1-54881] - Titration: 0.2-1 ug/ml, Positive Control: OVCAR-3 cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14679_DAK-Antibody-Western-Blot-NBP1-54881-img0004.jpg)
![Immunohistochemistry-Paraffin: DAK Antibody [NBP1-54881] - Human tonsil tissue 5ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14680_DAK-Antibody-Immunohistochemistry-Paraffin-NBP1-54881-img0003.jpg)
![Western Blot: DAK Antibody [NBP1-54881] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14681_DAK%2520Antibody-Western%2520Blot-NBP1-54881-img0005.jpg)