RSU1 Antibody
| Name | RSU1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-54879 |
| Prices | $299.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to RSU1(Ras suppressor protein 1) The peptide sequence was selected from the C terminal of RSU1. Peptide sequence PIADQFQLGVSHVFEYIRSETYKYLYGRHMQANPEPPKKNNDKSKKISRK. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | RSU1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: RSU1 Antibody [NBP1-54879] - Jurkat tissue lysate at a concentration of 1.25ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24826_RSU1-Antibody-Western-Blot-NBP1-54879-img0001.jpg)
Western Blot: RSU1 Antibody [NBP1-54879] - Jurkat tissue lysate at a concentration of 1.25ug/ml.
![Immunohistochemistry-Paraffin: RSU1 Antibody [NBP1-54879] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24827_RSU1-Antibody-Immunohistochemistry-Paraffin-NBP1-54879-img0002.jpg)
Immunohistochemistry-Paraffin: RSU1 Antibody [NBP1-54879] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.