TSKS Antibody
| Name | TSKS Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-54878 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to TSKS(testis-specific kinase substrate) The peptide sequence was selected from the N terminal of TSKS. Peptide sequence MASVVVKTIWQSKEIHEAGDTPTGVESCSQLVPEAPRRVTSRAKGIPKKK. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | TSKS |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: TSKS Antibody [NBP1-54878] - HepG2 cell lysate, concentration 1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14744_TSKS-Antibody-Western-Blot-NBP1-54878-img0001.jpg)
![Immunohistochemistry-Paraffin: TSKS Antibody [NBP1-54878] - Human Testis Tissue, 5.0ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14745_TSKS-Antibody-Immunohistochemistry-Paraffin-NBP1-54878-img0002.jpg)
![Immunohistochemistry: TSKS Antibody [NBP1-54878] - Staining of human Testis.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14746_TSKS%2520Antibody-Immunohistochemistry-NBP1-54878-img0003.jpg)