EHD4 Antibody

Name EHD4 Antibody
Supplier Novus Biologicals
Catalog NBP1-54873
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB IHC IHC-P
Species Reactivities Human
Antigen Synthetic peptides corresponding to EHD4(EH-domain containing 4) The peptide sequence was selected from the middle region of EHD4. Peptide sequence LMNLISQEETSTPTQLVQGGAFDGTTEGPFNQGYGEGAKEGADEEEWVVA.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene EHD4
Conjugate Unconjugated
Supplier Page Shop

Product images