| Name | FBXO25 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-55045 |
| Prices | $299.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to FBXO25(F-box protein 25) The peptide sequence was selected from the C terminal of FBXO25. Peptide sequence AKEQYGDTLHFCRHCSILFWKDSGHPCTAADPDSCFTPVSPQHFIDLFKF. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | FBXO25 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |