GMPPB Antibody
| Name | GMPPB Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-55168 |
| Prices | $139.00, $299.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to GMPPB(GDP-mannose pyrophosphorylase B) The peptide sequence was selected from the C terminal of GMPPB. Peptide sequence RCRVGQWVRMENVTVLGEDVIVNDELYLNGASVLPHKSIGESVPEPRIIM. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | GMPPB |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: GMPPB Antibody [NBP1-55168] - HepG2 cell lysate, concentration 5.0ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24828_GMPPB-Antibody-Western-Blot-NBP1-55168-img0001.jpg)
![Immunohistochemistry-Paraffin: GMPPB Antibody [NBP1-55168] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24829_GMPPB-Antibody-Immunohistochemistry-Paraffin-NBP1-55168-img0002.jpg)