Melusin/ITGB1BP2 Antibody
| Name | Melusin/ITGB1BP2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-55149 |
| Prices | $299.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to ITGB1BP2(integrin beta 1 binding protein (melusin) 2) The peptide sequence was selected from the N terminal of ITGB1BP2. Peptide sequence MSLLCRNKGCGQHFDPNTNLPDSCCHHPGVPIFHDALKGWSCCRKRTVDF. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | ITGB1BP2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: Melusin/ITGB1BP2 Antibody [NBP1-55149] - Titration: 2.5ug/ml Positive Control: Human heart.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24111_Melusin-ITGB1BP2-Antibody-Western-Blot-NBP1-55149-img0003.jpg)
![Immunohistochemistry-Paraffin: Melusin/ITGB1BP2 Antibody [NBP1-55149] - Human Muscle Tissue, Skeletal muscle cells (Indicated with Arrows) 4-8ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24112_Melusin-ITGB1BP2-Antibody-Immunohistochemistry-Paraffin-NBP1-55149-img0004.jpg)