OSBPL9 Antibody
| Name | OSBPL9 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-55152 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human, Mouse, Rat, Bovine, Dog, Horse, Rabbit, Zebrafish |
| Antigen | Synthetic peptides corresponding to OSBPL9(oxysterol binding protein-like 9) The peptide sequence was selected from the N terminal of OSBPL9. Peptide sequence HQTPTPNSTGSGHSPPSSSLTSPSHVNLSPNTVPEFSYSSSEDEFYDADE. |
| Purity/Format | Peptide affinity purified |
| Description | Rabbit Polyclonal |
| Gene | OSBPL9 |
| Supplier Page | Shop |
![Western Blot: OSBPL9 Antibody [NBP1-55152] - Jurkat cell lysate, Antibody Titration: 0.2-1 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/10146_OSBPL9%2520Antibody-Western%2520Blot-NBP1-55152-img0001.jpg)
![Immunohistochemistry-Paraffin: OSBPL9 Antibody [NBP1-55152] - Human Lung Alveolar cells (indicated with arrows), 4-8ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/10147_OSBPL9%2520Antibody-Immunohistochemistry-Paraffin-NBP1-55152-img0002.jpg)