Name | OSBPL9 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-55152 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB IHC IHC-P |
Species Reactivities | Human, Mouse, Rat, Bovine, Dog, Horse, Rabbit, Zebrafish |
Antigen | Synthetic peptides corresponding to OSBPL9(oxysterol binding protein-like 9) The peptide sequence was selected from the N terminal of OSBPL9. Peptide sequence HQTPTPNSTGSGHSPPSSSLTSPSHVNLSPNTVPEFSYSSSEDEFYDADE. |
Purity/Format | Peptide affinity purified |
Description | Rabbit Polyclonal |
Gene | OSBPL9 |
Supplier Page | Shop |