Name | FAIM1 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-55209 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB IHC IHC-P |
Species Reactivities | Human, Mouse, Rat, Pig, Bovine, Dog, Horse, Zebrafish |
Antigen | Synthetic peptides corresponding to FAIM(Fas apoptotic inhibitory molecule) The peptide sequence was selected from the N terminal of FAIM. Peptide sequence MTDLVAVWDVALSDGVHKIEFEHGTTSGKRVVYVDGKEEIRKEWMFKLVG. |
Purity/Format | Peptide affinity purified |
Description | Rabbit Polyclonal |
Gene | FAIM |
Supplier Page | Shop |