VARS Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-55366
• Prices: $139.00, $329.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB IHC IHC-P
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to VARS(valyl-tRNA synthetase) The peptide sequence was selected from the middle region of VARS. Peptide sequence VFDEFVDMDFGTGAVKITPAHDQNDYEVGQRHGLEAISIMDSRGALINVP.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: VARS
• Conjugate: Unconjugated

Product images

Western Blot: VARS Antibody [NBP1-55366] - Titration: 1.6 ug/ml Positive Control: human cell lines A431

Immunohistochemistry: VARS Antibody [NBP1-55366] - Human Lung Tissue Observed Staining: Cytoplasm of pneumocytes Primary Antibody Concentration: 1 : 100 Other Working Concentrations: 1/600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1 : 200 Magnification: 20X Exposure Time

Western Blot: VARS Antibody [NBP1-55366] - 721_B tissue lysate at a concentration of 1ug/ml.

Western Blot: VARS Antibody [NBP1-55366] - Titration: 1 ug/ml Positive Control: Wildtype Neurospora crassa