PSD3 Antibody
| Name | PSD3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-55339 |
| Prices | $299.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human, Mouse, Rat, Bovine, Horse, Guinea Pig, Zebrafish |
| Antigen | Synthetic peptides corresponding to PSD3(pleckstrin and Sec7 domain containing 3) The peptide sequence was selected from the middle region of PSD3. Peptide sequence SDVAKHLGKNNEFSKLVAEEYLKFFDFTGMTLDQSLRYFFKAFSLVGETQ. |
| Purity/Format | IgG purified |
| Description | Rabbit Polyclonal |
| Gene | PSD3 |
| Supplier Page | Shop |
![Western Blot: PSD3 Antibody [NBP1-55339] - A204 cell lysate, Antibody Titration: 2.5ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/10175_PSD3%2520Antibody-Western%2520Blot-NBP1-55339-img0001.jpg)
![Immunohistochemistry-Paraffin: PSD3 Antibody [NBP1-55339] - Human Muscle Tissue, Skeletal muscle cells (Indicated with Arrows) 4-8ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/10176_PSD3%2520Antibody-Immunohistochemistry-Paraffin-NBP1-55339-img0003.jpg)