TARS Antibody
| Name | TARS Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-55369 |
| Prices | $139.00, $299.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to TARS(threonyl-tRNA synthetase) The peptide sequence was selected from the N terminal of TARS. Peptide sequence PEYIYTRLEMYNILKAEHDSILAEKAEKDSKPIKVTLPDGKQVDAESWKT. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | TARS |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: TARS Antibody [NBP1-55369] - HepG2 cell lysate, concentration 5.0ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24390_TARS-Antibody-Western-Blot-NBP1-55369-img0001.jpg)
![Immunohistochemistry-Paraffin: TARS Antibody [NBP1-55369] - Human Stomach Tissue, Epithelial cells of funic gland (Indicated with Arrows) 4-8ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24391_TARS-Antibody-Immunohistochemistry-Paraffin-NBP1-55369-img0002.jpg)