SOX5 Antibody

Name SOX5 Antibody
Supplier Novus Biologicals
Catalog NBP1-74096
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to the C terminal of SOX5 (NP_821078). Immunizing peptide sequence PEPGMPVIQSTYGVKGEEPHIKEEIQAEDINGEIYDEYDEEEDDPDVDYG.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene SOX5
Conjugate Unconjugated
Supplier Page Shop

Product images