UBE2J2/UBC6 Antibody
| Name | UBE2J2/UBC6 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59760 |
| Prices | $299.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to UBE2J2(ubiquitin-conjugating enzyme E2, J2 (UBC6 homolog, yeast)) The peptide sequence was selected from the C terminal of UBE2J2. Peptide sequence GIQLLNGHAPGAVPNLAGLQQANRHHGLLGGALANLFVIVGFAAFAYTVK. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | UBE2J2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: UBE2J2/UBC6 Antibody [NBP1-59760] - Titration: 1.25ug/ml Positive Control: HepG2 cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24469_UBE2J2-UBC6-Antibody-Western-Blot-NBP1-59760-img0003.jpg)
Western Blot: UBE2J2/UBC6 Antibody [NBP1-59760] - Titration: 1.25ug/ml Positive Control: HepG2 cell lysate.
![Immunohistochemistry-Paraffin: UBE2J2/UBC6 Antibody [NBP1-59760] - Human Intestine Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Epithelial cells of intestinal villus (indicated with arrows) 400X magnification.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24470_UBE2J2-UBC6-Antibody-Immunohistochemistry-Paraffin-NBP1-59760-img0002.jpg)
Immunohistochemistry-Paraffin: UBE2J2/UBC6 Antibody [NBP1-59760] - Human Intestine Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Epithelial cells of intestinal villus (indicated with arrows) 400X magnification.