GAT-1/SLC6A1 Antibody
| Name | GAT-1/SLC6A1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59878 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB ICC/IF |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to SLC6A1(solute carrier family 6 (neurotransmitter transporter, GABA), member 1) The peptide sequence was selected from the middle region of SLC6A1. Peptide sequence CCINSCTSMFAGFVIFSIVGFMAHVTKRSIADVAASGPG |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | SLC6A1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: GAT1 Antibody [NBP1-59878] - Mouse Brain lysate, Antibody Titration: 0.2-1 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/4903_GAT1%2520Antibody-Western%2520Blot-NBP1-59878-img0001.jpg)
![Immunocytochemistry/Immunofluorescence: GAT1 Antibody [NBP1-59878] - mouse brain slices, 1:1000](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/4904_GAT1%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-59878-img0002.jpg)