ALG11 Antibody
| Name | ALG11 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-91577 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the C terminal of human ALG11. Peptide sequence LHTMWNEHFGIGVVECMAAGTIILAHNSGGPKLDIVIPHEGDITGFLAES. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | ALG11 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: ALG11 Antibody [NBP1-91577] - HepG2 cell lysate, Antibody Titration: 0.2-1 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24649_ALG11-Antibody-Western-Blot-NBP1-91577-img0001.jpg)
Western Blot: ALG11 Antibody [NBP1-91577] - HepG2 cell lysate, Antibody Titration: 0.2-1 ug/ml
![Immunohistochemistry-Paraffin: ALG11 Antibody [NBP1-91577] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24650_ALG11-Antibody-Immunohistochemistry-Paraffin-NBP1-91577-img0003.jpg)
Immunohistochemistry-Paraffin: ALG11 Antibody [NBP1-91577] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.