ATP6V1G2 Antibody (2E11.)

Name ATP6V1G2 Antibody (2E11.)
Supplier Novus Biologicals
Catalog H00000534-M02
Prices $359.00
Sizes 100 µg
Host Mouse
Clonality Monoclonal
Isotype IgG2b Lambda
Clone 2E11.
Applications WB ELISA
Species Reactivities Human, Rat
Antigen ATP6V1G2 (NP_569730, 41 a.a. - 118 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QMEVEQYRREREHEFQSKQQAAMGSQGNLSAEVEQATRRQVQGMQSSQQRNRERVLAQLLGMVCDVRPQVHPNYRISA
Purity/Format IgG purified
Description Mouse Monoclonal
Gene ATP6V1G2
Conjugate Unconjugated
Supplier Page Shop

Product images