PITX1 Antibody (5G4)

• Supplier: Novus Biologicals
• Catalog: H00005307-M01
• Prices: $359.00
• Sizes: 100 µg
• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a Kappa
• Clone: 5G4
• Applications: WB ELISA IP Gene Silencing
• Species Reactivities: Human
• Antigen: PITX1 (NP_002644 225 a.a. - 313 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MPSSMGPGAVPGMPNSGLNNINNLTGSSLNSAMSPGACPYGTPASPYSVYRDTCNSSLASLRLKSKQHSSFGYGGLQGPASGLNACQYN
• Purity/Format: IgG purified
• Description: Mouse Monoclonal
• Gene: PITX1
• Conjugate: Unconjugated

Product images

Western Blot: PITX1 Antibody (5G4) [H00005307-M01] - PITX1 monoclonal antibody (M01), clone 5G4 Analysis of PITX1 expression in Hela S3 NE.

Western Blot: PITX1 Antibody (5G4) [H00005307-M01] - Analysis of PITX1 over-expressed 293 cell line, cotransfected with PITX1 Validated Chimera RNAi ( Cat # H00005307-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with PITX1 monoclonal antibody (M01), clone 5G4 (Cat # H00005307-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.

Western Blot: PITX1 Antibody (5G4) [H00005307-M01] - Analysis of PITX1 expression in transfected 293T cell line by PITX1 monoclonal antibody (M01), clone 5G4.Lane 1: PITX1 transfected lysate(34.1 KDa).Lane 2: Non-transfected lysate.

Immunoprecipitation: PITX1 Antibody (5G4) [H00005307-M01] - Analysis of PITX1 transfected lysate using anti-PITX1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with PITX1 MaxPab rabbit polyclonal antibody.

Sandwich ELISA: PITX1 Antibody (5G4) [H00005307-M01] - Detection limit for recombinant GST tagged PITX1 is approximately 0.03ng/ml as a capture antibody.