gamma Adducin Antibody
| Name | gamma Adducin Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-34017 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: ASSVSQIQSQTQSPQNVPEKLEENHELFSKSFISMEVPVMVVNGKDDMHDVEDELAKRVSRLSTSTTIENIEITIKSPEKIEEVLSPE |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | gamma Adducin Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | ADD3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: gamma Adducin Antibody [NBP2-34017] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-229](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/6385_gamma-Adducin-Antibody-Western-Blot-NBP2-34017-img0005.jpg)
Western Blot: gamma Adducin Antibody [NBP2-34017] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-229
![Immunocytochemistry/Immunofluorescence: gamma Adducin Antibody [NBP2-34017] - Staining of human cell line HEK 293 shows localization to plasma membrane.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/6386_gamma-Adducin-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-34017-img0007.jpg)
Immunocytochemistry/Immunofluorescence: gamma Adducin Antibody [NBP2-34017] - Staining of human cell line HEK 293 shows localization to plasma membrane.
![Immunohistochemistry: gamma Adducin Antibody [NBP2-34017] - Staining of human stomach, lower shows strong cytoplasmic and membranous positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/6387_gamma-Adducin-Antibody-Immunohistochemistry-NBP2-34017-img0001.jpg)
Immunohistochemistry: gamma Adducin Antibody [NBP2-34017] - Staining of human stomach, lower shows strong cytoplasmic and membranous positivity in glandular cells.