Collagen VIII alpha 1 Antibody
| Name | Collagen VIII alpha 1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-13856 |
| Prices | $129.00, $419.00 |
| Sizes | 25 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: QGEYLPDMGLGIDGVKPPHAYGAKKGKNGGPAYEMPAFTAELTAPFPPVG APVKFNKLLYNGRQNYNPQ |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Collagen VIII alpha 1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | COL8A1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: Collagen VIII alpha 1 Antibody [NBP2-13856] - Staining of human soft tissue shows distinct positivity in internal elastic lamina of the blood vessel.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/19419_Collagen-VIII-alpha-1-Antibody-Immunohistochemistry-Paraffin-NBP2-13856-img0002.jpg)
Immunohistochemistry-Paraffin: Collagen VIII alpha 1 Antibody [NBP2-13856] - Staining of human soft tissue shows distinct positivity in internal elastic lamina of the blood vessel.