Acidic Calponin Antibody
| Name | Acidic Calponin Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-38643 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: PKYCAAPTEPVIHNGSQGTGTNGSEISDSDYQAEYPDEYHGEYQDDYPRDYQYSDQGIDY |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Acidic Calponin Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | CNN3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Acidic Calponin Antibody [NBP2-38643] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/15058_Acidic-Calponin-Antibody-Western-Blot-NBP2-38643-img0003.jpg)
Western Blot: Acidic Calponin Antibody [NBP2-38643] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG
![Immunocytochemistry/Immunofluorescence: Acidic Calponin Antibody [NBP2-38643] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & actin filaments.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/15059_Acidic%2520Calponin%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38643-img0004.jpg)
Immunocytochemistry/Immunofluorescence: Acidic Calponin Antibody [NBP2-38643] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & actin filaments.
![Immunohistochemistry: Acidic Calponin Antibody [NBP2-38643] - Staining of human small intestine shows distinct positivity in vessels.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/15060_Acidic-Calponin-Antibody-Immunohistochemistry-NBP2-38643-img0002.jpg)
Immunohistochemistry: Acidic Calponin Antibody [NBP2-38643] - Staining of human small intestine shows distinct positivity in vessels.