RCN3 Antibody
| Name | RCN3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-38627 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: EFPHMRDIVIAETLEDLDRNKDGYVQVEEYIADLYSAEPGEEEPAWVQTERQQFRDFRDL |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | RCN3 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | RCN3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: RCN3 Antibody [NBP2-38627] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/6881_RCN3-Antibody-Western-Blot-NBP2-38627-img0003.jpg)
Western Blot: RCN3 Antibody [NBP2-38627] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG
![Immunocytochemistry/Immunofluorescence: RCN3 Antibody [NBP2-38627] - Immunofluorescent staining of human cell line U-2 OS shows localization to endoplasmic reticulum & vesicles.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/6882_RCN3%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38627-img0004.jpg)
Immunocytochemistry/Immunofluorescence: RCN3 Antibody [NBP2-38627] - Immunofluorescent staining of human cell line U-2 OS shows localization to endoplasmic reticulum & vesicles.
![Immunohistochemistry: RCN3 Antibody [NBP2-38627] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/6883_RCN3-Antibody-Immunohistochemistry-NBP2-38627-img0002.jpg)
Immunohistochemistry: RCN3 Antibody [NBP2-38627] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.