non-muscle heavy chain 10 Myosin Antibody
| Name | non-muscle heavy chain 10 Myosin Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-38566 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: RQLDDATEANEGLSREVSTLKNRLRRGGPISFSSSRSGRRQLHLEGASLELSDDDTESKTSDVNETQPPQ |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | non-muscle heavy chain 10 Myosin Protein |
| Description | Rabbit Polyclonal |
| Gene | MYH10 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: non-muscle heavy chain 10 Myosin Antibody [NBP2-38566] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/5549_non-muscle%2520heavy%2520chain%252010%2520Myosin%2520Antibody-Immunohistochemistry-Paraffin-NBP2-38566-img0004.jpg)
Immunohistochemistry-Paraffin: non-muscle heavy chain 10 Myosin Antibody [NBP2-38566] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.