SPATA5 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP2-38302
• Prices: $419.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB ICC/IF IHC IHC-P
• Species Reactivities: Human
• Antigen: This antibody was developed against a recombinant protein corresponding to amino acids: SLELSLQLSQLDLEDTQIPTSRSTPYKPIDDRITNKASDVLLDVTQSPGDGSGLMLEEVTGLKCNFESAREGNEQLT
• Purity/Format: Immunogen affinity purified
• Blocking Peptide: SPATA5 Recombinant Protein Antigen
• Description: Rabbit Polyclonal
• Gene: SPATA5
• Conjugate: Unconjugated

Product images

Western Blot: SPATA5 Antibody [NBP2-38302] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: Human liver tissue. Lane 6: Human tonsil tissue

Immunocytochemistry/Immunofluorescence: SPATA5 Antibody [NBP2-38302] - Staining of human cell line U-2 OS shows positivity in cytoplasm.

Immunohistochemistry: SPATA5 Antibody [NBP2-38302] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.