Rpn2 Antibody
| Name | Rpn2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-38323 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: GAFEESLNYALGAGDLFNVNDNSEYVETIIAKCIDHYTKQCVENADLPEGEKKPIDQRLEGIVNKMFQRCLDDHKYKQAIGIALE |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Rpn2 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | PSMD1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Rpn2 Antibody [NBP2-38323] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: Human liver tissue. Lane 6: Human tonsil tissue](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/15018_Rpn2-Antibody-Western-Blot-NBP2-38323-img0003.jpg)
Western Blot: Rpn2 Antibody [NBP2-38323] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
![Immunocytochemistry/Immunofluorescence: Rpn2 Antibody [NBP2-38323] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & actin filaments.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/15019_Rpn2%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38323-img0004.jpg)
Immunocytochemistry/Immunofluorescence: Rpn2 Antibody [NBP2-38323] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & actin filaments.
![Immunohistochemistry: Rpn2 Antibody [NBP2-38323] - Staining of human cerebral cortex shows strong nuclear positivity in neuronal cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/15020_Rpn2-Antibody-Immunohistochemistry-NBP2-38323-img0002.jpg)
Immunohistochemistry: Rpn2 Antibody [NBP2-38323] - Staining of human cerebral cortex shows strong nuclear positivity in neuronal cells.