GRSF1 Antibody
| Name | GRSF1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-38341 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB ICC/IF IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: YSQESKTTYLEDLPPPPEYELAPSKLEEEVDDVFLIRAQGLPWSCTMEDVLNFFSDCRIRNGEN |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | GRSF1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | GRSF1 |
| Supplier Page | Shop |
Product images
![Western Blot: GRSF1 Antibody [NBP2-38341] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: RT-4](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/16228_GRSF1%2520Antibody-Western%2520Blot-NBP2-38341-img0003.jpg)
Western Blot: GRSF1 Antibody [NBP2-38341] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: RT-4
![Immunocytochemistry/Immunofluorescence: GRSF1 Antibody [NBP2-38341] - Immunofluorescent staining of human cell line U-251 MG shows positivity in mitochondria.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/16229_GRSF1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38341-img0001.jpg)
Immunocytochemistry/Immunofluorescence: GRSF1 Antibody [NBP2-38341] - Immunofluorescent staining of human cell line U-251 MG shows positivity in mitochondria.
![Immunohistochemistry: GRSF1 Antibody [NBP2-38341] - Staining of human stomach, upper shows strong granular cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/16230_GRSF1-Antibody-Immunohistochemistry-NBP2-38341-img0002.jpg)
Immunohistochemistry: GRSF1 Antibody [NBP2-38341] - Staining of human stomach, upper shows strong granular cytoplasmic positivity in glandular cells.