FAM98A Antibody
| Name | FAM98A Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-38291 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: PLLEDGALSQAVSAGASSPEFTKLCAWLVSELRVLCKLEENVQATNSPSEAEEFQLEVSGLLGEMNCPYLSLTSGDVTKRLLIQKNCL |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | FAM98A Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | FAM98A |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: FAM98A Antibody [NBP2-38291] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: Human liver tissue](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/6946_FAM98A-Antibody-Western-Blot-NBP2-38291-img0003.jpg)
Western Blot: FAM98A Antibody [NBP2-38291] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: Human liver tissue
![Immunocytochemistry/Immunofluorescence: FAM98A Antibody [NBP2-38291] - Immunofluorescent staining of human cell line A-431 shows localization to vesicles.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/6947_FAM98A%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38291-img0005.jpg)
Immunocytochemistry/Immunofluorescence: FAM98A Antibody [NBP2-38291] - Immunofluorescent staining of human cell line A-431 shows localization to vesicles.
![Immunohistochemistry-Paraffin: FAM98A Antibody [NBP2-38291] - Staining of human nasopharynx shows strong positivity in respiratory epithelial cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/6948_FAM98A-Antibody-Immunohistochemistry-Paraffin-NBP2-38291-img0004.jpg)
Immunohistochemistry-Paraffin: FAM98A Antibody [NBP2-38291] - Staining of human nasopharynx shows strong positivity in respiratory epithelial cells.