PNPT1 Antibody
| Name | PNPT1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-38211 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: FMPLVVDYRQKAAAAGRIPTNYLRREIGTSDKEILTSRIIDRSIRPLFPAGYFYDTQVLCNLLAVDGVNEPDVLAINGASVALSLSDIPWNGPVGAVR |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | PNPT1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | PNPT1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: PNPT1 Antibody [NBP2-38211] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/6349_PNPT1-Antibody-Western-Blot-NBP2-38211-img0003.jpg)
Western Blot: PNPT1 Antibody [NBP2-38211] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG
![Immunocytochemistry/Immunofluorescence: PNPT1 Antibody [NBP2-38211] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/6350_PNPT1%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38211-img0004.jpg)
Immunocytochemistry/Immunofluorescence: PNPT1 Antibody [NBP2-38211] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
![Immunohistochemistry: PNPT1 Antibody [NBP2-38211] - Staining of human rectum shows strong cytoplasmic positivity with a granular pattern in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/6351_PNPT1-Antibody-Immunohistochemistry-NBP2-38211-img0002.jpg)
Immunohistochemistry: PNPT1 Antibody [NBP2-38211] - Staining of human rectum shows strong cytoplasmic positivity with a granular pattern in glandular cells.