PPP1R7 Antibody
| Name | PPP1R7 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-38207 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB ICC/IF IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: LENNNKLTMLDIASNRIKKIENISHLTELQEFWMNDNLLESWSDLDELKGARSLETVYLERNPLQKDPQYRRKVMLALPSVRQIDATF |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | PPP1R7 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | PPP1R7 |
| Supplier Page | Shop |
Product images
![Western Blot: PPP1R7 Antibody [NBP2-38207] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: RT-4<br/>Lane 3: U-251 MG<br/>Lane 4: Human Plasma<br/>Lane 5: Liver<br/>Lane 6: Tonsil](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/16300_PPP1R7%2520Antibody-Western%2520Blot-NBP2-38207-img0003.jpg)
Western Blot: PPP1R7 Antibody [NBP2-38207] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
![Immunocytochemistry/Immunofluorescence: PPP1R7 Antibody [NBP2-38207] - Immunofluorescent staining of human cell line A-431 shows positivity in nucleoli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/16301_PPP1R7-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38207-img0001.jpg)
Immunocytochemistry/Immunofluorescence: PPP1R7 Antibody [NBP2-38207] - Immunofluorescent staining of human cell line A-431 shows positivity in nucleoli.
![Immunohistochemistry: PPP1R7 Antibody [NBP2-38207] - Staining of human testis shows strong cytoplasmic and nuclear positivity in cells in seminiferus ducts.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/16302_PPP1R7-Antibody-Immunohistochemistry-NBP2-38207-img0002.jpg)
Immunohistochemistry: PPP1R7 Antibody [NBP2-38207] - Staining of human testis shows strong cytoplasmic and nuclear positivity in cells in seminiferus ducts.