AFTPH Antibody

• Supplier: Novus Biologicals
• Catalog: NBP2-38227
• Prices: $419.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB ICC/IF IHC IHC-P
• Species Reactivities: Human
• Antigen: This antibody was developed against a recombinant protein corresponding to amino acids: DSVPNIQDDCNGFQDSDDFADFSSAGPSQVVDWNAFEDEQKDSCSWAAFGDQQATESHHRKEAWQSHRTDENIDTPGTPKTHSVP
• Purity/Format: Immunogen affinity purified
• Blocking Peptide: AFTPH Recombinant Protein Antigen
• Description: Rabbit Polyclonal
• Gene: AFTPH
• Conjugate: Unconjugated

Product images

Western Blot: AFTPH Antibody [NBP2-38227] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative Control. Lane 3: Overexpression lysate

Immunocytochemistry/Immunofluorescence: AFTPH Antibody [NBP2-38227] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol, the Golgi apparatus & vesicles.

Immunohistochemistry: AFTPH Antibody [NBP2-38227] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.