TJAP1 Antibody
| Name | TJAP1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-38152 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: SASSEEDLLVSWQRAFVDRTPPPAAVAQRTAFGRDALPELQRHFAHSPADRDEVVQAPSARPEESELLLPTEP |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | TJAP1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | TJAP1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: TJAP1 Antibody [NBP2-38152] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative Control. Lane 3: Overexpression lysate](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/6952_TJAP1-Antibody-Western-Blot-NBP2-38152-img0003.jpg)
Western Blot: TJAP1 Antibody [NBP2-38152] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative Control. Lane 3: Overexpression lysate
![Immunocytochemistry/Immunofluorescence: TJAP1 Antibody [NBP2-38152] - Immunofluorescent staining of human cell line A-431 shows localization to the Golgi apparatus.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/6953_TJAP1%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38152-img0005.jpg)
Immunocytochemistry/Immunofluorescence: TJAP1 Antibody [NBP2-38152] - Immunofluorescent staining of human cell line A-431 shows localization to the Golgi apparatus.
![Immunohistochemistry-Paraffin: TJAP1 Antibody [NBP2-38152] - Staining of human placenta shows strong cytoplasmic positivity with a granular pattern in trophoblastic cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/6954_TJAP1-Antibody-Immunohistochemistry-Paraffin-NBP2-38152-img0004.jpg)
Immunohistochemistry-Paraffin: TJAP1 Antibody [NBP2-38152] - Staining of human placenta shows strong cytoplasmic positivity with a granular pattern in trophoblastic cells.