ZNF692 Antibody
| Name | ZNF692 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-37973 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: GLVWECSAGHTFSWGPSLSPTPSEAPKPASLPHTTRRSWCSEATSGQELADLESEHDERTQEARLPRRVGPPPETFP |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | ZNF692 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | ZNF692 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: ZNF692 Antibody [NBP2-37973] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: Human liver tissue](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/28647_ZNF692-Antibody-Western-Blot-NBP2-37973-img0003.jpg)
Western Blot: ZNF692 Antibody [NBP2-37973] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: Human liver tissue
![Immunocytochemistry/Immunofluorescence: ZNF692 Antibody [NBP2-37973] - Staining of human cell line HeLa shows positivity in nucleus.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/28648_ZNF692-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-37973-img0001.jpg)
Immunocytochemistry/Immunofluorescence: ZNF692 Antibody [NBP2-37973] - Staining of human cell line HeLa shows positivity in nucleus.
![Immunohistochemistry-Paraffin: ZNF692 Antibody [NBP2-37973] - Staining of human bone marrow shows strong cytoplasmic positivity in hematopoietic cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/28649_ZNF692-Antibody-Immunohistochemistry-Paraffin-NBP2-37973-img0004.jpg)
Immunohistochemistry-Paraffin: ZNF692 Antibody [NBP2-37973] - Staining of human bone marrow shows strong cytoplasmic positivity in hematopoietic cells.