Smoothelin Antibody
| Name | Smoothelin Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-37971 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: PVARSEEPGAPLPVAVGTAEPGGSMKTTFTIEIKDGRGQASTGRVLLPTGNQRAELTLGLRAPPTLLSTSSGGKSTITRVNSPGT |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Smoothelin Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | SMTN |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: Smoothelin Antibody [NBP2-37971] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/16515_Smoothelin%2520Antibody-Western%2520Blot-NBP2-37971-img0003.jpg)
![Immunohistochemistry-Paraffin: Smoothelin Antibody [NBP2-37971] - Staining of human smooth muscle shows moderate cytoplasmic positivity in smooth muscle cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/16516_Smoothelin-Antibody-Immunohistochemistry-Paraffin-NBP2-37971-img0004.jpg)