C6orf97 Antibody
| Name | C6orf97 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-37860 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB ICC/IF IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: RMVSQLEAQISELVEQLGKESGFHQKALQRAQKAENMLETLQGQLTHLEAELVSGGVLRDNLNFEKQKYLKFLDQLSQKMKLDQMA |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | C6orf97 Protein |
| Description | Rabbit Polyclonal |
| Gene | CCDC170 |
| Supplier Page | Shop |
Product images
![Western Blot: C6orf97 Antibody [NBP2-37860] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Negative Control<br/>Lane 3: LY410933](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/16428_C6orf97%2520Antibody-Western%2520Blot-NBP2-37860-img0003.jpg)
Western Blot: C6orf97 Antibody [NBP2-37860] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative Control
Lane 3: LY410933
![Immunocytochemistry/Immunofluorescence: C6orf97 Antibody [NBP2-37860] - Immunofluorescent staining of human cell line MCF7 shows positivity in the Golgi apparatus and cell junctions.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/16429_C6orf97-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-37860-img0001.jpg)
Immunocytochemistry/Immunofluorescence: C6orf97 Antibody [NBP2-37860] - Immunofluorescent staining of human cell line MCF7 shows positivity in the Golgi apparatus and cell junctions.
![Immunohistochemistry: C6orf97 Antibody [NBP2-37860] - Staining of human stomach shows distinct cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/16430_C6orf97-Antibody-Immunohistochemistry-NBP2-37860-img0002.jpg)
Immunohistochemistry: C6orf97 Antibody [NBP2-37860] - Staining of human stomach shows distinct cytoplasmic positivity in glandular cells.