NVL Antibody
| Name | NVL Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-37862 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: YTESYSDDDSSMEDYPDPQSANHMNSSLLSLYRKGNPDSVSNTPEMEQRETTSSTPRISSKTGSIPLKTPAKDSEGGWFIDKTPSVKKDSFFLDLSCE |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | NVL Protein |
| Description | Rabbit Polyclonal |
| Gene | NVL |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: NVL Antibody [NBP2-37862] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/8438_NVL%2520Antibody-Western%2520Blot-NBP2-37862-img0003.jpg)
Western Blot: NVL Antibody [NBP2-37862] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG
![Immunohistochemistry: NVL Antibody [NBP2-37862] - Staining of human esophagus shows moderate nucleolar positivity in squamous epithelial cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/8439_NVL-Antibody-Immunohistochemistry-NBP2-37862-img0002.jpg)
Immunohistochemistry: NVL Antibody [NBP2-37862] - Staining of human esophagus shows moderate nucleolar positivity in squamous epithelial cells.