NVL Antibody
| Name | NVL Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-37861 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: VNRVLMKLQEQQKKNPEMEDLPSKGVQEERLGTEPTSETQDELQRLLGLLRDQDPLSEEQMQGLCIELNDFIVALSSVQPSAKREGFVTVPN |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | NVL Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | NVL |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: NVL Antibody [NBP2-37861] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/16505_NVL-Antibody-Western-Blot-NBP2-37861-img0003.jpg)
Western Blot: NVL Antibody [NBP2-37861] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG
![Immunocytochemistry/Immunofluorescence: NVL Antibody [NBP2-37861] - Immunofluorescent staining of human cell line HEK 293 shows localization to nucleoli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/16506_NVL%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-37861-img0004.jpg)
Immunocytochemistry/Immunofluorescence: NVL Antibody [NBP2-37861] - Immunofluorescent staining of human cell line HEK 293 shows localization to nucleoli.
![Immunohistochemistry: NVL Antibody [NBP2-37861] - Staining of human skin shows nucleolar positivity in epidermal cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/16507_NVL-Antibody-Immunohistochemistry-NBP2-37861-img0002.jpg)
Immunohistochemistry: NVL Antibody [NBP2-37861] - Staining of human skin shows nucleolar positivity in epidermal cells.