ARVCF Antibody
| Name | ARVCF Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-38999 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: DDTRSLAADDEGGPELEPDYGTATRRRPECGRGLHTRAYEDTADDGGELADERPAFPMVTAP |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | ARVCF Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | ARVCF |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: ARVCF Antibody [NBP2-38999] - Immunofluorescent staining of human cell line SH-SY5Y shows localization to plasma membrane & cell junctions.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/10640_ARVCF%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38999-img0005.jpg)
Immunocytochemistry/Immunofluorescence: ARVCF Antibody [NBP2-38999] - Immunofluorescent staining of human cell line SH-SY5Y shows localization to plasma membrane & cell junctions.
![Immunohistochemistry-Paraffin: ARVCF Antibody [NBP2-38999] - Staining of human epididymis shows strong cell membrane positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/10641_ARVCF-Antibody-Immunohistochemistry-Paraffin-NBP2-38999-img0004.jpg)
Immunohistochemistry-Paraffin: ARVCF Antibody [NBP2-38999] - Staining of human epididymis shows strong cell membrane positivity in glandular cells.