COBLL1 Antibody
| Name | COBLL1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-38697 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: DEKEELSEVPKVEAENISPKSQDIPFVSTDIINTLKNDPDSALGNGSGEFSQNSMEEKQETKSTDGQEPHSVVYDTSNGKKVVDSIRNLKSLG |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | COBLL1 Protein |
| Description | Rabbit Polyclonal |
| Gene | COBLL1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: COBLL1 Antibody [NBP2-38697] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/14850_COBLL1-Antibody-Western-Blot-NBP2-38697-img0003.jpg)
Western Blot: COBLL1 Antibody [NBP2-38697] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG
![Immunocytochemistry/Immunofluorescence: COBLL1 Antibody [NBP2-38697] - Staining of human cell line HeLa shows localization to nucleoplasm, plasma membrane & cytosol.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/14851_COBLL1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38697-img0004.jpg)
Immunocytochemistry/Immunofluorescence: COBLL1 Antibody [NBP2-38697] - Staining of human cell line HeLa shows localization to nucleoplasm, plasma membrane & cytosol.
![Immunohistochemistry-Paraffin: COBLL1 Antibody [NBP2-38697] - Staining of human placenta shows strong cytoplasmic and membranous positivity in trophoblastic cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/14852_COBLL1-Antibody-Immunohistochemistry-Paraffin-NBP2-38697-img0005.jpg)
Immunohistochemistry-Paraffin: COBLL1 Antibody [NBP2-38697] - Staining of human placenta shows strong cytoplasmic and membranous positivity in trophoblastic cells.