PSMA4 Antibody
| Name | PSMA4 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-38754 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: MEAIGHAGTCLGILANDGVLLAAERRNIHKLLDEVFFSEKIYKLNEDMACSVAGITSDANVLTNELRLIAQRYLLQYQEPIPCEQLVTALCDIKQA |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | PSMA4 Protein |
| Description | Rabbit Polyclonal |
| Gene | PSMA4 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: PSMA4 Antibody [NBP2-38754] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: Human liver tissue. Lane 6: Human tonsil tissue](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/14602_PSMA4-Antibody-Western-Blot-NBP2-38754-img0003.jpg)
Western Blot: PSMA4 Antibody [NBP2-38754] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
![Immunocytochemistry/Immunofluorescence: PSMA4 Antibody [NBP2-38754] - Staining of human cell line U-2 OS shows localization to nucleus & cytosol.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/14603_PSMA4-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38754-img0004.jpg)
Immunocytochemistry/Immunofluorescence: PSMA4 Antibody [NBP2-38754] - Staining of human cell line U-2 OS shows localization to nucleus & cytosol.
![Immunohistochemistry: PSMA4 Antibody [NBP2-38754] - Staining of human stomach, lower shows moderate cytoplasmic and nuclear positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/14604_PSMA4-Antibody-Immunohistochemistry-NBP2-38754-img0002.jpg)
Immunohistochemistry: PSMA4 Antibody [NBP2-38754] - Staining of human stomach, lower shows moderate cytoplasmic and nuclear positivity in glandular cells.