FAM120A Antibody
| Name | FAM120A Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-38771 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: FYPASAYPRHFGPVPPSQGRGRGFAGVCGFGGPYGETVATGPYRAFRVAAASGHCGAFSGSDSSRTSKSQGGVQPIP |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | FAM120A Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | FAM120A |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Immunocytochemistry/Immunofluorescence: FAM120A Antibody [NBP2-38771] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/6279_FAM120A%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38771-img0004.jpg)
![Immunohistochemistry: FAM120A Antibody [NBP2-38771] - Staining of human stomach shows moderate cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/6280_FAM120A-Antibody-Immunohistochemistry-NBP2-38771-img0002.jpg)