SAPS3 Antibody
| Name | SAPS3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-34048 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: DGAKQDLFEPSSANTEDKMEVDLSEPPNWSANFDVPMETTHGAPLDSVGSDVWSTEEPMPTKETGWASFSEFTSSLSTKDSLRSNSPVEMETSTEP |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | SAPS3 Protein |
| Description | Rabbit Polyclonal |
| Gene | PPP6R3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: SAPS3 Antibody [NBP2-34048] - Immunofluorescent staining of human cell line CACO-2 shows localization to nucleoplasm, plasma membrane & cytosol.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/6642_SAPS3%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-34048-img0005.jpg)
Immunocytochemistry/Immunofluorescence: SAPS3 Antibody [NBP2-34048] - Immunofluorescent staining of human cell line CACO-2 shows localization to nucleoplasm, plasma membrane & cytosol.
![Immunohistochemistry-Paraffin: SAPS3 Antibody [NBP2-34048] - Staining of human prostate shows strong cytoplasmic and nuclear positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/6643_SAPS3-Antibody-Immunohistochemistry-Paraffin-NBP2-34048-img0002.jpg)
Immunohistochemistry-Paraffin: SAPS3 Antibody [NBP2-34048] - Staining of human prostate shows strong cytoplasmic and nuclear positivity in glandular cells.