GLIS3 Antibody
| Name | GLIS3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-33787 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: SPGHNVQGSPHNPSSQLPPLTAVDAGAERFAPSAPSPHHISPRRVPAPSSILQRTQPPYTQQPSGSHLKSYQPETNSSFQPNGI |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | GLIS3 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | GLIS3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: GLIS3 Antibody [NBP2-33787] - Immunofluorescent staining of human cell line A549 shows localization to nucleoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/6383_GLIS3%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-33787-img0008.jpg)
Immunocytochemistry/Immunofluorescence: GLIS3 Antibody [NBP2-33787] - Immunofluorescent staining of human cell line A549 shows localization to nucleoplasm.
![Immunohistochemistry-Paraffin: GLIS3 Antibody [NBP2-33787] - Staining of human thyroid gland shows moderate nuclear positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/6384_GLIS3-Antibody-Immunohistochemistry-Paraffin-NBP2-33787-img0007.jpg)
Immunohistochemistry-Paraffin: GLIS3 Antibody [NBP2-33787] - Staining of human thyroid gland shows moderate nuclear positivity in glandular cells.