DDX52 Antibody
| Name | DDX52 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-33776 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: KFDTRRFSADAARFQIGKRKYDFDSSEVLQGLDFFGNKKSVPGVCGASQTHQKPQNGEKKEESLTERKREQSKKKRKTMTSEIAS |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | DDX52 |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: DDX52 Antibody [NBP2-33776] - Immunofluorescent staining of human cell line A-549 shows positivity in nucleus & nucleoli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/16860_DDX52-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-33776-img0001.jpg)
Immunocytochemistry/Immunofluorescence: DDX52 Antibody [NBP2-33776] - Immunofluorescent staining of human cell line A-549 shows positivity in nucleus & nucleoli.
![Immunohistochemistry-Paraffin: DDX52 Antibody [NBP2-33776] - liver](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/16861_DDX52-Antibody-Immunohistochemistry-Paraffin-NBP2-33776-img0003.jpg)
Immunohistochemistry-Paraffin: DDX52 Antibody [NBP2-33776] - liver
![Immunohistochemistry-Paraffin: DDX52 Antibody [NBP2-33776] - Immunohistochemical staining of human cerebral cortex shows strong nuclear positivity in neuronal cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/16862_DDX52-Antibody-Immunohistochemistry-Paraffin-NBP2-33776-img0002.jpg)
Immunohistochemistry-Paraffin: DDX52 Antibody [NBP2-33776] - Immunohistochemical staining of human cerebral cortex shows strong nuclear positivity in neuronal cells.
![Immunohistochemistry-Paraffin: DDX52 Antibody [NBP2-33776] - liver cancer](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/16863_DDX52%2520Antibody-Immunohistochemistry-Paraffin-NBP2-33776-img0004.jpg)
Immunohistochemistry-Paraffin: DDX52 Antibody [NBP2-33776] - liver cancer