Aquaporin-3 Antibody

Name Aquaporin-3 Antibody
Supplier Novus Biologicals
Catalog NBP2-33872
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB ICC/IF IHC IHC-P
Species Reactivities Human
Antigen This antibody was developed against a recombinant protein corresponding to amino acids: QLMIGCHLEQPPPSNEEENVKLAHVKHKEQI
Purity/Format Immunogen affinity purified
Blocking Peptide Aquaporin-3 Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene AQP3
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.