SLC44A4 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP2-33707
• Prices: $419.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB IHC IHC-P
• Species Reactivities: Human
• Antigen: This antibody was developed against a recombinant protein corresponding to amino acids: MTVITSLQQELCPSFLLPSAPALGRCFPWTNVTPPALPGITNDTTIQQGISGLIDSLNARDISVKIFED
• Purity/Format: Immunogen affinity purified
• Blocking Peptide: SLC44A4 Recombinant Protein Antigen
• Description: Rabbit Polyclonal
• Gene: SLC44A4

Product images

Western Blot: SLC44A4 Antibody [NBP2-33707] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4

Immunohistochemistry-Paraffin: SLC44A4 Antibody [NBP2-33707] - liver cancer

Immunohistochemistry-Paraffin: SLC44A4 Antibody [NBP2-33707] - Immunohistochemical staining of human fallopian tube shows strong membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: SLC44A4 Antibody [NBP2-33707] - fallopian tube