DLL3 Antibody
| Name | DLL3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-33273 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: RVCLKPGLSEEAAESPCALGAALSARGPVYTEQPGAPAPDLPLPDGLLQVPF |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | DLL3 Protein |
| Description | Rabbit Polyclonal |
| Gene | DLL3 |
| Supplier Page | Shop |
Product images
![Western Blot: DLL3 Antibody [NBP2-33273] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/17000_DLL3-Antibody-Western-Blot-NBP2-33273-img0004.jpg)
Western Blot: DLL3 Antibody [NBP2-33273] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp
![Immunohistochemistry: DLL3 Antibody [NBP2-33273] - Liver cancer](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/17001_DLL3-Antibody-Immunohistochemistry-NBP2-33273-img0003.jpg)
Immunohistochemistry: DLL3 Antibody [NBP2-33273] - Liver cancer
![Immunohistochemistry: DLL3 Antibody [NBP2-33273] - Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/17002_DLL3-Antibody-Immunohistochemistry-NBP2-33273-img0001.jpg)
Immunohistochemistry: DLL3 Antibody [NBP2-33273] - Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.
![Immunohistochemistry: DLL3 Antibody [NBP2-33273] - Ovary](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/17003_DLL3-Antibody-Immunohistochemistry-NBP2-33273-img0002.jpg)
Immunohistochemistry: DLL3 Antibody [NBP2-33273] - Ovary