PBX2 Antibody
| Name | PBX2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-31853 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: GDSYSASQVESLRHSMGPGGYGDNLGGGQMYSPREMRANGSW |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | PBX2 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | PBX2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: PBX2 Antibody [NBP2-31853] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/15872_PBX2-Antibody-Western-Blot-NBP2-31853-img0004.jpg)
Western Blot: PBX2 Antibody [NBP2-31853] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
![Immunocytochemistry/Immunofluorescence: PBX2 Antibody [NBP2-31853] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/15873_PBX2%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-31853-img0006.jpg)
Immunocytochemistry/Immunofluorescence: PBX2 Antibody [NBP2-31853] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
![Immunohistochemistry-Paraffin: PBX2 Antibody [NBP2-31853] - Staining of human nasopharynx shows strong nuclear positivity in respiratory epithelial cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/15874_PBX2-Antibody-Immunohistochemistry-Paraffin-NBP2-31853-img0007.jpg)
Immunohistochemistry-Paraffin: PBX2 Antibody [NBP2-31853] - Staining of human nasopharynx shows strong nuclear positivity in respiratory epithelial cells.