EPB41L1 Antibody
| Name | EPB41L1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-31650 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: KKAQEEAPQQPEAAAAVTTPVTPAGHGHPEANSNEKHPSQQDTRPAEQSLDMEEKDYSEADGLSERTTPSKAQKSPQKIAK |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | EPB41L1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | EPB41L1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: EPB41L1 Antibody [NBP2-31650] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/13742_EPB41L1%2520Antibody-Western%2520Blot-NBP2-31650-img0004.jpg)
Western Blot: EPB41L1 Antibody [NBP2-31650] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
![Immunohistochemistry: EPB41L1 Antibody [NBP2-31650] - Staining of human cerebral cortex shows strong positivity in neuropil and a subset of glial cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/13743_EPB41L1-Antibody-Immunohistochemistry-NBP2-31650-img0003.jpg)
Immunohistochemistry: EPB41L1 Antibody [NBP2-31650] - Staining of human cerebral cortex shows strong positivity in neuropil and a subset of glial cells.
![Western Blot: EPB41L1 Antibody [NBP2-31650] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/13744_EPB41L1-Antibody-Western-Blot-NBP2-31650-img0002.jpg)
Western Blot: EPB41L1 Antibody [NBP2-31650] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
![Immunohistochemistry: EPB41L1 Antibody [NBP2-31650] - Staining of human cerebral cortex shows strong positivity in neuropil and a subset of glial cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/13745_EPB41L1-Antibody-Immunohistochemistry-NBP2-31650-img0001.jpg)
Immunohistochemistry: EPB41L1 Antibody [NBP2-31650] - Staining of human cerebral cortex shows strong positivity in neuropil and a subset of glial cells.