SUHW3 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP2-33618
• Prices: $419.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB ICC/IF IHC IHC-P
• Species Reactivities: Human
• Antigen: This antibody was developed against a recombinant protein corresponding to amino acids: VSKSSQSSVTVENASKPDFTKNSQVGSDNSSILLFDSTQESLPPSQDIPAIFREGMKNTSYVLKHPSTSKVNSVTPKKPKTSEDV
• Purity/Format: Immunogen affinity purified
• Blocking Peptide: SUHW3 Recombinant Protein Antigen
• Description: Rabbit Polyclonal
• Gene: ZNF280C
• Conjugate: Unconjugated

Product images

Western Blot: SUHW3 Antibody [NBP2-33618] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp

Immunocytochemistry/Immunofluorescence: SUHW3 Antibody [NBP2-33618] - Immunofluorescent staining of human cell line SH-SY5Y shows localization to nucleus & nucleoli fibrillar center.

Immunohistochemistry-Paraffin: SUHW3 Antibody [NBP2-33618] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.